PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT00694
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 568aa    MW: 63816.3 Da    PI: 7.6832
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT00694genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.84.4e-12109149445
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      W ++E+ ll+++++++G g+W+ +a+++g +++  qc++++ 
         EMT00694 109 WNADEEILLLEGIEMYGLGNWAEVAEHVG-TKSKAQCIEHYT 149
                      *****************************.**********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0250246.1E-17837564IPR016827Transcriptional adaptor 2
SMARTSM002916.1E-114590IPR000433Zinc finger, ZZ-type
PfamPF005697.7E-104788IPR000433Zinc finger, ZZ-type
PROSITE profilePS5013511.1844992IPR000433Zinc finger, ZZ-type
SuperFamilySSF578509.42E-1549112No hitNo description
CDDcd023351.38E-254997No hitNo description
PROSITE patternPS0135705178IPR000433Zinc finger, ZZ-type
SuperFamilySSF466891.27E-12102155IPR009057Homeodomain-like
PROSITE profilePS5129322.742104156IPR017884SANT domain
SMARTSM007174.1E-11105154IPR001005SANT/Myb domain
PfamPF002496.6E-12108149IPR001005SANT/Myb domain
CDDcd001671.16E-11109150No hitNo description
Gene3DG3DSA:1.10.10.601.3E-8109151IPR009057Homeodomain-like
SuperFamilySSF466891.06E-21467557IPR009057Homeodomain-like
PROSITE profilePS509349.179477568IPR007526SWIRM domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009631Biological Processcold acclimation
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0016573Biological Processhistone acetylation
GO:0042127Biological Processregulation of cell proliferation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 568 aa     Download sequence    Send to blast
MGRSRGVPNS GDDDTNHRSK RRRVASTGDA SDSLSAACGG AGDGKKALYH CNYCNKDLSG  60
KIRFKCSKCP DFDLCVECFS VGAEVTPHRS NHPYRVMDNL SFPLICPDWN ADEEILLLEG  120
IEMYGLGNWA EVAEHVGTKS KAQCIEHYTT AYMNSPCYPL PDMSHVNGKN RKELLAMAKV  180
QGESKKGIPL LSGDLTPKAE SPFSPSRIKM EDALGEGPAS RSPSHIPGGA NKKASTVGHF  240
KDSANLSKVE DGHMDRSIGV KKPRYSADEG PSLTELSGYN AKRHEFDPEY DNDAEQALAE  300
MEFKETDSET DRELKLRVLR IYLSRLDERK RRKEFILERN LLYPNPLEKD LTNEDKEVYH  360
RYKVFMRFLS KEEHEALVRS VIEERKIRRR IQELQECRSA GCRTLAEAKI HIEQKRRKEY  420
EANALKAKES GQLISNSKSG HKTNRPMKLE TDGSLDLKKG SAILDAGGRD SPKTTGPTSA  480
KQWDDWDIVG LPGAELLSSS EKLLCCQNRL LPSHYLRMQE VLMQEMFKGN VVKKEDAHVL  540
FKVDPAKVDT VYDMVMKKLG NNEEAPMV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11923KRRRV
2328333RKRRKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3662460.0AK366246.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2041G24.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003559501.10.0PREDICTED: transcriptional adapter ADA2
SwissprotQ75LL60.0TADA2_ORYSJ; Transcriptional adapter ADA2
TrEMBLW5FR530.0W5FR53_WHEAT; Uncharacterized protein
TrEMBLR7VYP10.0R7VYP1_AEGTA; Transcriptional adapter ADA2
STRINGMLOC_34938.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77083847